PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aan007215
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
Family M-type_MADS
Protein Properties Length: 255aa    MW: 29432.1 Da    PI: 4.9453
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Artemisia_annua-95459PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.75.4e-17447245
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
               +i+++ +r++tf +R++g++K A ELS+LCd++v++ii s +++
  Aan007215  4 PINDSKKRKITFLRRKEGLIKNARELSTLCDINVSMIICSDHQE 47
               799*************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.755144IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-6154IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.01E-15269IPR002100Transcription factor, MADS-box
CDDcd001201.73E-12243No hitNo description
PfamPF003192.4E-15546IPR002100Transcription factor, MADS-box
ProDomPD0029380.00947114IPR001742Outer capsid protein VP2, Orbivirus
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0019028Cellular Componentviral capsid
GO:0003677Molecular FunctionDNA binding
GO:0005198Molecular Functionstructural molecule activity
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
XMEPINDSKK RKITFLRRKE GLIKNARELS TLCDINVSMI ICSDHQESPE IFPQDPAKLN  60
EMINTYKRKR VSDPGKIKSY GLCDYWNDRK NKTEDELAKV KKRNLEAKFP TSVECLDSSS  120
EEQLRDFAYG LGIQIDEVGS KMPLLNPNPM ITMMTHFDHN YNDNTSIVSD NHVESSGSSN  180
ITNVDNGYYP IVPMDQIFFG TDQRLMEALN MSSMKSEDVN DCYDGPKFDL KPEKMQQLEQ  240
PQSMDMQRLM QSCFY
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.17e-10AGAMOUS-like 82